Bioinformàtica i experiències en l'àmbit de suport cientificotècnic

Toni Hermoso Pulido - @toniher

UAB - 14 de desembre del 2021

En l'àmbit del coneixement lliure

~1997

La informació vol ser lliure

On the one hand information wants to be expensive, because it's so valuable. The right information in the right place just changes your life. On the other hand, information wants to be free, because the cost of getting it out is getting lower and lower all the time. So you have these two fighting against each other.

Stewart Brand,  Hackers Conference (1984)

Programari lliure

Richard M. Stalman com a Saint Ignucius

(font)

Softcatalà

Mozilla i codi obert

Viquipèdia

Jimmy Wales (font)

Larry Sanger (font)

2001

Una enciclopèdia on tothom hi pot editar

També els robots...

Diderobot (font)

Citation Needed!

Viquitrobades comunitat catalana

A la Facultat de (Bio)ciències de la UAB

Imatges de Wikimedia Commons - Toniher

(1998-2002)

A l'Institut de Biotecnologia i Biomedicina - UAB

Imatge de Picassa, Google - 2015

(~2002-2007 i més enllà...)

A l'Institut de Biotecnologia i Biomedicina - UAB

Oscar Conchillo, Antonio Gomez, Narcís Fernandez, Jordi Espadaler, Juan Cedano, Daniel Aguilar, etc.

A l'Institut de Biotecnologia i Biomedicina - UAB

A l'Institut de Biotecnologia i Biomedicina - UAB

ArchDB

TrsDB

A l'Institut de Biotecnologia i Biomedicina - UAB

Bypass

A l'Institut de Biotecnologia i Biomedicina - UAB

Logo representation of metallocarboxypeptidases
CPN structure

Al Centre de Regulació Genòmica

Toniher, 2019 (CC-BY-SA)

(des del 2009)

Al Centre de Regulació Genòmica

Al Centre de Regulació Genòmica

Database and resources maintenance

>protein S
SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIR
GWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVY
SSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQ
GFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFL
LKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITN
LCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCF
TNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYN
YLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPY
RVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFG
RDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAI
HADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR
RARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTM

Al Centre de Regulació Genòmica

Working collaboratively with wikis

Al Centre de Regulació Genòmica

Scientific websites and webservices

Al Centre de Regulació Genòmica

Websites and webservices

Al Centre de Regulació Genòmica

Pipeline development

Al Centre de Regulació Genòmica

Open Science

...

Divulgació viquipedista

al PRBB

A la Societat Catalana de Biologia

Casa de la Convalescència, Josep Renalias (2008, CC-BY-SA 3.0)

Societat Catalana de Biologia

Primera filial de l'IEC, 1912

Kippelboy, CC BY-SA 3.0
Viquimarató Ángeles Santos Museu de l'Empordà març 2012
Kippelboy, CC BY 4.0

Toniher, CC-BY-SA 2.0

Recomanacions al llarg de la carrera

 

  • Identifica allò que t'agradi

 

  • Identifica allò que facis bé

 

  • Permet-te temps de reflexió i opinió amb tercers

 

  • Identifica allò que et pugui fer créixer

Recomanacions al llarg de la carrera

 

  • Identifica allò que et pugui fer créixer

 

  • Estigues en un entorn amb gent millor que tu (ni que sigui en alguns aspectes)
  • Evitar ser com un pet bioinformatician o en defecte compensa-ho (relaciona't amb iguals d'arreu del món, fes ús d'Internet)

 

Recomanacions al llarg de la carrera

 

  • Identifica allò que et pugui fer créixer

 

  • Genera't reptes (publica articles, aprèn llenguatge de programació, certificacions, etc.)
  • No siguis a llocs que no et permetin o donin suport a formació
  • Compte estacament!

 

  • Dilema especialista vs generalista

 

Recomanacions al llarg de la carrera

 

Soft skills!

 

Organització

Raonament

Comunicació

etc.

 

 

Gràcies!

@toniher

Bioinformàtica i experiències en l'àmbit de suport cientificotècnic

By Similis.cc

Bioinformàtica i experiències en l'àmbit de suport cientificotècnic

Presentació en l'espai d'ocupabilitat de la Facultat de Biociències de la UAB - 14 de desembre de 2021

  • 263