Disseny i aplicació de bases de dades biològiques per a la classificació i anotació de proteïnes

Toni Hermoso Pulido (ORCID, Google Scholar)

Opció al Doctorat de Biotecnologia

IBB - UAB

 

 

Directors:

Enric Querol

Francesc Xavier Avilés

Objectius

  • Posar al dia diferents aplicacions bioinformàtiques desenvolupades anys abans a l'IBB-UAB.
    • Per utilitzar-les en llocs i serveis web accessibles per a tota la comunitat científica.
    • Per acoblar-les a diferents processos d'anàlisi massius (resultat dels projectes de seqüenciació de genomes).
  • Dissenyar repositoris de coneixement  (bases de dades) que permetin accedir als anàlisis  resultants de les anteriors aplicacions i altres.

Objectius

  • Implementar un entorn d'anàlisis de seqüències per tal que eines populars de tercers, com ara el BLAST, com les anteriorment esmentades desenvolupades a l'IBB, puguin utilitzar-se sense necessitat de grans coneixements tècnics.
  • Recerca i determinació funcional, estructural i filogenètica de nous membres de la família de les proteïnes metal·locarboxipeptidades.

 

Dades biològiques

Modelització biològica

A

Formats bioinformàtics

FASTA

>sp|Q9BTV4|TMM43_HUMAN Transmembrane protein
MAANYSSTSTRREHVKVKTSSQPGFLERLSETSGGMFVGLMAFLLSFYLIFTNEGRALKT
ATSLAEGLSLVVSPDSIHSVAPENEGRLVHIIGALRTSKLLSDPNYGVHLPAVKLRRHVE
MYQWVETEESREYTEDGQVKKETRYSYNTEWRSEIINSKNFDREIGHKNPSAMAVESFMA
TAPFVQIGRFFLSSGLIDKVDNFKSLSLSKLEDPHVDIIRRGDFFYHSENPKYPEVGDLR
VSFSYAGLSGDDPDLGPAHVVTVIARQRGDQLVPFSTKSGDTLLLLHHGDFSAEEVFHRE
LRSNSMKTWGLRAAGWMAMFMGLNLMTRILYTLVDWFPVFRDLVNIGLKAFAFCVATSLT
LLTVAAGWLFYRPLWALLIAGLALVPILVARTRVPAKKLE

Formats bioinformàtics

PDB

ATOM      1  N   HIS A   1A     16.838 -16.537 -15.237  1.00 58.22           N  
ATOM      2  CA  HIS A   1A     15.999 -17.073 -14.177  1.00 57.61           C  
ATOM      3  C   HIS A   1A     15.313 -15.951 -13.398  1.00 56.85           C  
ATOM      4  O   HIS A   1A     15.739 -14.799 -13.451  1.00 54.65           O  
ATOM      5  CB  HIS A   1A     16.818 -17.936 -13.211  1.00 59.70           C  
ATOM      6  CG  HIS A   1A     18.008 -17.208 -12.662  1.00 61.33           C  
ATOM      7  ND1 HIS A   1A     19.282 -17.394 -13.150  1.00 62.30           N  
ATOM      8  CD2 HIS A   1A     18.126 -16.283 -11.684  1.00 61.06           C  
ATOM      9  CE1 HIS A   1A     20.127 -16.621 -12.488  1.00 62.16           C  
ATOM     10  NE2 HIS A   1A     19.450 -15.935 -11.584  1.00 61.36           N  
ATOM     11  N   HIS A   2A     14.260 -16.335 -12.694  1.00 55.96           N  
ATOM     12  CA  HIS A   2A     13.485 -15.490 -11.802  1.00 55.45           C  
ATOM     13  C   HIS A   2A     12.710 -14.403 -12.538  1.00 49.55           C  
ATOM     14  O   HIS A   2A     12.408 -13.349 -11.974  1.00 47.18           O  
ATOM     15  CB  HIS A   2A     14.410 -14.891 -10.737  1.00 61.53           C  
ATOM     16  CG  HIS A   2A     14.735 -15.881  -9.655  1.00 66.23           C  
ATOM     17  ND1 HIS A   2A     13.775 -16.384  -8.802  1.00 67.88           N  
ATOM     18  CD2 HIS A   2A     15.895 -16.458  -9.272  1.00 68.10           C  
ATOM     19  CE1 HIS A   2A     14.331 -17.228  -7.947  1.00 69.31           C  
ATOM     20  NE2 HIS A   2A     15.625 -17.291  -8.214  1.00 69.65           N  
ATOM     21  N   GLY A   3A     12.370 -14.682 -13.795  1.00 44.60           N  
ATOM     22  CA  GLY A   3A     11.616 -13.760 -14.621  1.00 41.29           C  
ATOM     23  C   GLY A   3A     12.481 -12.660 -15.198  1.00 37.90           C  
ATOM     24  O   GLY A   3A     12.002 -11.758 -15.886  1.00 35.74           O  
ATOM     25  N   GLY A   4A     13.782 -12.724 -14.927  1.00 35.35           N  
ATOM     26  CA  GLY A   4A     14.672 -11.669 -15.390  1.00 33.87           C  
ATOM     27  C   GLY A   4A     14.604 -11.547 -16.899  1.00 33.53           C  
ATOM     28  O   GLY A   4A     14.757 -10.459 -17.447  1.00 35.80           O  
ATOM     29  N   GLU A   5A     14.379 -12.668 -17.579  1.00 35.10           N  
ATOM     30  CA  GLU A   5A     14.368 -12.630 -19.040  1.00 37.50           C  
ATOM     31  C   GLU A   5A     13.352 -11.623 -19.568  1.00 37.65           C  
ATOM     32  O   GLU A   5A     13.587 -10.974 -20.594  1.00 37.89           O  

Formats bioinformàtics

GFF

Dogma central

Font: Commons

##gff-version 3
#!genome-build ASM2734v1
#!genome-version GCA_000027345.1
#!genome-date 2014-01
#!genome-build-accession GCA_000027345.1
#!genebuild-last-updated 2014-01
Chromosome      ena     gene    380541  381527  .       +       .       ID=MPN_320;Name=thyA
Chromosome      ena     mRNA    380541  381527  .       +       .       ID=AAB96164;Name=thyA-1;Parent=MPN_320
Chromosome      ena     start_codon     380541  380543  .       +       0       ID=start_codon:AAB96164:1;Parent=AAB96164
Chromosome      ena     CDS     380541  381527  .       +       0       ID=CDS:AAB96164:1;Parent=AAB96164
Chromosome      ena     transcript      380541  381527  .       +       .       ID=transcript:AAB96164:1;Parent=AAB96164
Chromosome      ena     exon    380541  381527  .       +       .       ID=exon:AAB96164:1;Parent=AAB96164
Chromosome      ena     stop_codon      381525  381527  .       +       0       ID=stop_codon:AAB96164:1;Parent=AAB96164
Chromosome      ena     gene    293265  294107  .       +       .       ID=MPN_241;Name=MPN_241
Chromosome      ena     mRNA    293265  294107  .       +       .       ID=AAB96238;Parent=MPN_241
Chromosome      ena     start_codon     293265  293267  .       +       0       ID=start_codon:AAB96238:1;Parent=AAB96238
Chromosome      ena     CDS     293265  294107  .       +       0       ID=CDS:AAB96238:1;Parent=AAB96238
Chromosome      ena     exon    293265  294107  .       +       .       ID=exon:AAB96238:1;Parent=AAB96238
Chromosome      ena     transcript      293265  294107  .       +       .       ID=transcript:AAB96238:1;Parent=AAB96238
Chromosome      ena     stop_codon      294105  294107  .       +       0       ID=stop_codon:AAB96238:1;Parent=AAB96238
Chromosome      ena     gene    760403  760948  .       +       .       ID=MPN_634;Name=MPN_634
Chromosome      ena     mRNA    760403  760948  .       +       .       ID=AAB95856;Parent=MPN_634
Chromosome      ena     start_codon     760403  760405  .       +       0       ID=start_codon:AAB95856:1;Parent=AAB95856
Chromosome      ena     CDS     760403  760948  .       +       0       ID=CDS:AAB95856:1;Parent=AAB95856
Chromosome      ena     transcript      760403  760948  .       +       .       ID=transcript:AAB95856:1;Parent=AAB95856
Chromosome      ena     exon    760403  760948  .       +       .       ID=exon:AAB95856:1;Parent=AAB95856
Chromosome      ena     stop_codon      760946  760948  .       +       0       ID=stop_codon:AAB95856:1;Parent=AAB95856
Chromosome      ena     gene    773342  773752  .       -       .       ID=MPN_648;Name=MPN_648
Chromosome      ena     mRNA    773342  773752  .       -       .       ID=AAB95842;Parent=MPN_648
Chromosome      ena     start_codon     773750  773752  .       -       0       ID=start_codon:AAB95842:1;Parent=AAB95842
Chromosome      ena     CDS     773342  773752  .       -       0       ID=CDS:AAB95842:1;Parent=AAB95842
Chromosome      ena     transcript      773342  773752  .       -       .       ID=transcript:AAB95842:1;Parent=AAB95842
Chromosome      ena     exon    773342  773752  .       -       .       ID=exon:AAB95842:1;Parent=AAB95842
Chromosome      ena     stop_codon      773342  773344  .       -       0       ID=stop_codon:AAB95842:1;Parent=AAB95842
Chromosome      ena     gene    728749  729738  .       -       .       ID=MPN_609;Name=pstB

Formats NO bioinformàtics

P. ex. full de càlcul amb dades diverses

Bases de dades relacionals

Esquema d'una taula

  • Atribut, Camp, Columna
  • Tupla, fila
  • Taula, relació

Relacions entre taules

Esquema d'una BD

Esquema d'ENSEMBL Compara

SQL

Llenguatge de consulta estructurat

SQL - Definició de taula

CREATE TABLE `translation` (
  `translation_id` int(10) unsigned NOT NULL AUTO_INCREMENT,
  `transcript_id` int(10) unsigned NOT NULL,
  `seq_start` int(10) NOT NULL,
  `start_exon_id` int(10) unsigned NOT NULL,
  `seq_end` int(10) NOT NULL,
  `end_exon_id` int(10) unsigned NOT NULL,
  `stable_id` varchar(128) DEFAULT NULL,
  `version` smallint(5) unsigned NOT NULL DEFAULT '1',
  `created_date` datetime NOT NULL DEFAULT '0000-00-00 00:00:00',
  `modified_date` datetime NOT NULL DEFAULT '0000-00-00 00:00:00',
  PRIMARY KEY (`translation_id`),
  KEY `transcript_idx` (`transcript_id`),
  KEY `stable_id_idx` (`stable_id`,`version`)
);

SQL - SELECT

SELECT translation_id, seq_start, seq_end 

from translation 

where transcript_id='ENST00000296026';

Aplicacions bioinformàtiques

ProtLoc

(Cedano et al., 1997)

CODE

ProtLoc

Localitzacions cel·lulars

Source - NSF - Commons: How proteins are made?

ProtLoc - Premisses

  • Assignar una ubicació cel·lular només amb la seqüència primària d'una proteïna
  • Localitzacions assignables:
    • INTRACEL·LULAR
    • EXTRACEL·LULAR
    • MEMBRANA
    • ANCORADA
    • NUCLEAR

ProtLoc

Distància de Mahalanobis

ProtLoc

Resultats

Membrane => 8.04007866311015
Anchored => 8.70351093081404
Nuclear => 8.92771314050655
Intracellular => 9.33241032405688
Extracellular => 11.0166179413074
TMM43_HUMAN (Transmembrane protein 43)

Aplicacions bioinformàtiques

TransMem

CODE

(Aloy et al., 1997)

TransMem

Dominis transmembrana

TransMem - Premisses

  • Assignar dominis transmembrana només amb la seqüència primària d'una proteïna
  • Ajustament de la finestra de detecció - ref.: 20 aa per hèlix transmembrana

TransMem

SNNS (Stuttgart Neural Network Simulator)

Xarxa Neuronal Artificial

TransMem

Resultats

$ ./transmem -w 10 Q9BTV4.fasta
sp|Q9BTV4|TMM43_HUMAN GMFVGLMAFLLSFYL 34 49
sp|Q9BTV4|TMM43_HUMAN VESFMATAPF 174 184
sp|Q9BTV4|TMM43_HUMAN IGRFFLSSGL 186 196
sp|Q9BTV4|TMM43_HUMAN AAGWMAMFMGLNLM 312 326
sp|Q9BTV4|TMM43_HUMAN LVNIGLKAFAFCVATSLTLLTVAAGWLF 342 370
sp|Q9BTV4|TMM43_HUMAN LWALLIAGLALVPIL 373 388

Transmembrane protein 43

Aplicacions bioinformàtiques

TranScout

(Aguilar et al., 2002)

TranScout

Factors de transcripció

Source: Commons - Leucine Zipper

TranScout - Premisses

  • Detecció de diferents tipus de factors de transcripció a partir de diferents perfils de seqüència
  • Exemple de tipus:

TranScout

Perfils de seqüència

TranScout

Matriu de puntuació específica de posició (PSSM)

Exemple de PSSM de tipus zinc finger

TranScout

Resultat

QUERY    KRPRTAFTAEQ-LQRLKNEFQNNRYLTEQRR-QALAQELGLNESQIKIWFQNKRAKIK
MOTIF    pphpphhpppphhp-hppphphNpYLpRpRRhE-hAphLpLpERQhKIhhpppphphp
INICIO    173
FINAL    228
SIGN    Antennapedia type of homeotic transcription factors
CLASS    Family
FUNC    DNA-binding
SCORE    22.93
SCRNRM    0.40
SCRMAX    33.91
SCRMIN    16.64
RANK    PROBABLE

Aplicacions de bases de dades en biologia

Referència del sector - NAR DB issue: http://www.oxfordjournals.org/nar/database/c/

Basades en els programes anteriors

TrSDB

Base de dades de factors de transcripció en eucariotes

(Hermoso et al., 2004)

Fonts i programes que s'han utilitzat

  • IPI i SwissProt-TrEMBL --> Avui UniProt
  • InterPro (aglutina diferents BDs)
  • InterPro2GO - GOA -> Anotació funcional
  • ProtLoc
  • TransMem
  • TranScout

Perspectiva

Perspectiva

Resultats

Resultats

ArchDB

Base de dades de llaços de proteïnes

(Espadaler et al., 2004)
(Hermoso et al., 2007)

Paràmetres per a la classificació de llaços

  • Assignació estructura secundària
  • Conformació phi-psi (Ramachandran)
  • Geometria (angles i distància) dels llaços

Mapa de Ramachandran

Source: Commons

Source: Commons

Geometria dels llaços de proteïnes

  • rho
  • delta
  • theta
  • D

Flux de l'ArchDB

Classificació

AR beta-beta link

EH beta-alpha

HA beta-beta hairpin

HE alpha-beta

HH alpha-alpha

Perspectiva

Perspectiva

Plataforma d'anotació de proteïnes

Objectius

  • Enviar dades biològiques (seqüències, pero potencialment també altres)
  • Gestionar-les (tenir-les) en un mateix lloc
  • Aplicar-les-hi anàlisis i relacionar-ne els resultats

NoSQL

NoSQL

Not Only SQL

  • No només SQL
  • Sistemes de bases de dades no relacionals
  • Molts tipus:
    • Clau-valor
    • Documents
    • Grafs
    • Mixtes
    • etc.

Bases de dades de documents

CouchDB

Què entenem a CouchDB per document?

  • Unitats diferenciades de dades (p. ex., 1 anàlisi de BLAST)
  • Subjectes a operacions CRUD
    • Create (Crear)
    • Read (Llegir)
    • Update (Actualitzar)
    • Delete (Suprimir)
  • Amb una clau unívoca
  • Revisions
  • Diferents grups (i jerarquies) de dades

Document

Resultat XML de BLAST

Document JSON

Un mateix resultat de BLAST

Document en CouchDB

Resultat de Bypass

Característiques respecte al model de BD relacional

  • Sense un esquema predefinit
  • El document determina l'esquema i cada document en pot tenir un diferent
  • El model passa a nivell de programari

Bases de dades

de grafs

Neo4j

Grafs

  • Vèrtexs o nodes
  • Arestes o relacions
  • Propietats o atributs
  • Etiquetes

 

 

Els grafs explicats

amb un graf

Tipus de grafs

Jerarquia simple. Regla directa.

1 pare.

Taxonomia NCBI.

Graf acíclic directe. Regles directes, però >= 1 pare.

Gene Ontology (3).

Graf no directe. Els nodes poden ser tan pares com fills.

Xarxes metabòliques.

Graf taxonomia NCBI

Visualització Neo4j

Ontologia component cel·lular del GO

Mapa d'interacció de proteïnes de llevat

Ancestre comú més baix

Exemple: LCA GO de proteïnes

Bypass

Reanotació funcional basada

en lògica difusa

(Gómez et al., 2008)

BLAST

BLAST i PSI-BLAST

Moonlighting

  • Moonlighting: de l'anglès, treballar en una altra feina apart de la principal (normalment durant la nit) - Escena Taxi Driver
  • Biomolècules amb una funcionalitat addicional a una canònica
  • Relacionat: promiscuïtat enzimàtica 

Lògica difusa

Font: Commons

Paràmetres del Bypass

  • Composició d'aminoàcids
    • Distància de dissimilaritat euclidiana del conjunt
  • Longitud de la seqüència
  • Perfil hidropàtic
    • Kyte-Doolittle
  • Perfil de flexibilitat
    • Karplus & Schulz

Flux del Bypass

Reordenació de resultats de PSI-BLAST

Exemples de moonlighting coincidents amb resultats de Bypass i interactòmica

Més exemples a MultitaskProtDB

(Hernández et al., 2014)

Integració en plataforma

Entrada de dades i anàlisi

Reordenació amb Bypass

Integració amb API GO

Futures implementacions

  • Importació i exportació més fàcil (ara mitjançant scripts)
  • Integrar més microserveis WWW ( TransMem, ProtLoc, altres externs)
  • Major control de la creació del perfil de PSSM del PSI-BLAST
  • Parametritzar millor el Bypass

M14D

Una 'jove' subfamília de metal·locarboxipeptidases

Metal·locarboxipeptidases

  • Exopeptidases. Tallen extrem C-terminal pèptids
    • En contraposició a aminopeptidases i endopeptidases
  • El centre actiu té un metall (majoritàriament zinc).
    • Altres carboxipeptidases ho fan mitjançant serina o cisteïna.

Metal·locarboxipeptidases

  • Alguns membres (especialment si s'excreten fora de la cel·lula) tenen una forma inactiva (zimògen/proenzim) amb un domini protector.
  • Família M14 al Merops - la base de dades de referència de peptidases

Metal·locarboxipeptidases

Metal·locarboxipeptidases

Residus rellevants

Variacions en els residus d'unió a zinc en les diferents famílies de metal·locarboxipetidases

Recerca de nous membres de la família M14

(Rodriguez de la Vega et al., 2007)

(Kalinina et al., 2007)

TubCP =? Nna1 =? M14D (CCP)

  • La literatura es referia fa temps a una activitat tubulin-carboxipeptidasa al citosol, però d'una proteïna indeterminada
  • Nna1 - associat a desordre neuronal (pcd en ratolí - degeneració de cel·lules de Purkinje)
  • Suposadament també alguns membres amb possibilitat d'unir ATP/GTP (AGTPBP1 en humans )

Generació d'alineaments

Origen: Merops M14D

Perfil amb un model ocult de Markov

Diversitat de la subfamília

Les 6 carboxipeptidases citosòliques (CCP - M14D) de ratolí.

Font: (Kalinina et al., 2007)

Diversitat de la subfamília

Font: (Rodriguez de la Vega et al., 2007)

Arbre filogenètic

Font: (Rodriguez de la Vega et al., 2007)

Modelització estructural

Modelització per homologia

  • Utilitzat MODELLER (Sali Lab)
  • Procediment:
    • Es parteix d'unes estructures 3D ja existents (PDB)
    • Es creen alineaments entre les seqüències de les estructures i la nostra seqüència problema
    • ->

Modelització per homologia

  • Utilitzat MODELLER (Sali Lab)
  • Procediment:
    • <-
    • Córrer diferents iteracions
      • Variacions entre models: p. ex., en els llaços generats
    • Revisió dels models

Preparació d'alienaments per a MODELLER

>P1;1aye
structure:1aye:34C  : :11  : :33-401::-1.00:-1.00
QLDFWKSPTT--------PGETAHVRVPFVNVQAVKVFLESQGIAYSIMIEDVQVLLDKENEEMLFNRRRERSG
NFNFGA
---------------------------------------------------------------------
--------------------------------------------------------------------------
--------------------------------------------------------------------------
--------------------------------------------------------------------------
-------*

>P1;1h8lA
structure:1h8l:7    :A:383  :A:4-380::-1.00:-1.00
--------------------------------------------------------------------------
QPVDFRHHHFSDMEIFLRRYANEYPSITRLYSVGKSVELRELYVMEISDNPGIHEAGEPEFKYIGNMHGNEVVGR
ELLLNL
IEYLCKNFGTDPEVTDLVQSTRIHIMPSMNPDGYEKSQEGDRGGTVGRNNSNNYDLNRNFPDQFFQVTD
PPQPETLAVMSWLKTYPFVLSANLHGGSLVVNYPFDDDEQGI-----AIYSKSPDDAVFQQLALSYSKENKKMYQ
GSPCKDLYPTEYFPHGITNGAQWYNVPGGMQDWNYLNTNCFEVTIELGCVKYPKAEELPKYWEQNRRSLLQFIKQ
VHRGIWGFVLDATDGRGILNATISVADINHPVTTYKDGDYWRLLVQGTYKVTASARGYDPVTKTVEVDSKGGVQV
NFTLSRT*

>P1;CPM
sequence:model:     : :     : :CPM 10-462::-1.00:-1.00
HSQTHRRPTMILRTPLVAGHQLQLLLLPSVLLLMLHLLLCDAKTVNPGDSMQMQHHQMTAEPGLPEPRAYMPDA
QHLDFV
YHDHEELTRFLRATSARYPNLTALYSIGKSIQGRDLWVMVVSSSPYEHMVGKPDVKYVGNIHGNEPVGR
EMLLHLIQYFVTSYNTDQYVKWLLDNTRIHILPTMNPDGYAVSKEGTCDGGQGRYNARGFDLNRNFPDYFKQNNK
RGQPETDSVKDWISKIQFVLSGSLHGGALVASYPYDNTPNSMFQTYSAAPSLTPDDDVFKHLSLVYARNHAKMSR
GVACKSA--TPAFENGITNGAAWYPLTGGMQDYNYVWYGCMEITLEISCCKFPPAYELKKYWEDNQLSLIKFLAE
AHRGVQGFVFDPA-GMPIERASIKIKGRDVGFQTTKYGEFWRILLPGYYKVEVFAEGFAPREVEFVIVEQHPTLL
NVTLQPS*

Exemple d'aplicació

Model de M14D - Homòleg d'AGBL4 a C. elegans (ceAGBL4). Plantilles: CPA pancreàtica de Bos taurus (2ctc) i Sus scrofa (1pca), carboxipeptidasa pancreàtica B (CPB) de Sus scrofa (1nsa) i CPT de Thermoactinomyces vulgaris (1obr)
 

Font: (Rodriguez de la Vega et al., 2007)

Estat actual CCP - M14D

  • CCP1 en ratolí (cpd) demostrat que intervé en el processament Glu de la α- i β-tubulina (Berezniuk et al., 2012)
    • Membres clau en el processament de microtúbuls (regeneració axons, etc.)
  • Estructura de CCP de bacteri Pseudomonas aeruginosa - PaCCP (Otero et al., 2012)
    • Nou domini pro
    • Possibilitats per a millors modelitzacions

Conclusions finals

  • Es van reescriure, adaptar o encapsular diferents aplicacions (ProtLoc, TransMem, TranScout i Bypass).
    • Van poder utilitzar-se en processament massiu de dades dels projectes genoma.
    • Van poder exposar-se al públic com a llocs web.
    • Esdevé possible integrar-les com a serveis web per a ser utilitzades en entorns WWW.

Conclusions finals

  • Es van dissenyar bases de dades de coneixement d'accés públic d'entitats d'interès biològic.
    • TrSDB. Repositori de factors de transcripció coneguts i putatius a partir dels anàlisis amb dades públiques i les aplicacions abans esmentades.
    • ArchDB. Repositori de llaços de proteïnes categoritzats segons criteris estructurals, geomètrics i funcionals.

Conclusions finals

  • Es va implementar un entorn d'anàlisi funcional de seqüències de proteïnes.
    • Aglutinant anàlisis de (PSI-)BLAST, Bypass i altres aplicacions.
    • Experimentant amb tecnologies NoSQL per a l'emmagatzemament de les dades.
    • Permetent a l'usuari valorar una anotació mitjançant la integració amb Gene Ontology i taxonomia via microserveis web.

Conclusions finals

  • Es va determinar una nova subfamília de metal·locarboxipeptidades (M14D)
    • Mitjançant cerca en bases de dades públiques van trobar-se representants en gran nombre d'organismes i es va proposar una història filogenètica de tot el grup.
    • Es van generar models estructurals per donar suport a una possible funció catalítica.
    • En definitiva, es va obrir un camp de recerca; confirmant-se després la importància en processos cabdals com el processament de microtúbuls.

Publicacions

Hermoso, A., Aguilar, D., Aviles, F. X., & Querol, E. (2004). TrSDB: a proteome database of transcription factors. Nucleic Acids Research, 32(Database issue), D171–D173.
Espadaler, J., Fernandez-Fuentes, N., Hermoso, A., Querol, E., Aviles, F. X., Sternberg, M. J. E., & Oliva, B. (2004). ArchDB: automated protein loop classification as a tool for structural genomics. Nucleic Acids Research, 32(Database issue), D185–D188.
Hermoso, A., Espadaler, J., Enrique Querol, E., Aviles, F. X., Sternberg, M. J. E., Oliva, B., … Fernandez-Fuentes, N. (2007). Including Functional Annotations and Extending the Collection of Structural Classifications of Protein Loops (ArchDB). Bioinformatics and Biology Insights, 1, 77.

Publicacions

Gómez, A., Cedano, J., Espadaler, J., Hermoso, A., Piñol, J., & Querol, E. (2008). Prediction of protein function improving sequence remote alignment search by a fuzzy logic algorithm. Protein Journal, 27(2), 130–139.
Hernández, S., Calvo, A., Ferragut, G., Franco, L., Hermoso, A., Amela, I., … Cedano, J. (2014). Can bioinformatics help in the identification of moonlighting proteins? Biochemical Society Transactions, 42(6), 1692–7.
Hernández, S., Franco, L., Calvo, A., Ferragut, G., Hermoso, A., Amela, I., … Cedano, J. (2015). Bioinformatics and Moonlighting Proteins. Frontiers in Bioengineering and Biotechnology, 3, 90.

Publicacions

Rodriguez de la Vega, M., Sevilla, R. G., Hermoso, A., Lorenzo, J., Tanco, S., Diez, A., … Avilés, F. X. (2007). Nna1-like proteins are active metallocarboxypeptidases of a new and diverse M14 subfamily. FASEB Journal, 21(3), 851–865
Kalinina, E., Biswas, R., Berezniuk, I., Hermoso, A., Aviles, F. X., & Fricker, L. D. (2007). A novel subfamily of mouse cytosolic carboxypeptidases. FASEB Journal, 21(3), 836–50.

Gràcies a

Disseny i aplicació de bases de biològiques per a la classificació i anotació de proteïnes

By Similis.cc

Disseny i aplicació de bases de biològiques per a la classificació i anotació de proteïnes

Presentació de defensa de tesi de Toni Hermoso Pulido

  • 7,998
Loading comments...

More from Similis.cc